DPCstruct | MC17945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4QYE4 | 136-297 | ICSYHFNHDQKNLHNPGFKKTKNTGQSILHRKRCLFCGKLFYFFTRGLGCEKHSWNIIGKNIQVVCNGQVNCSALESYDSVCKRHNE… |
| A0A2I1FR17 | 1-142 | MKESQKRKCLFCGKLFYFFGRGNGCSKHSQKLLGKNIQVACNRQHTCPALGECNLICKPALEDTKYSCYICSECYELEGGHFHVKPG… |
| A0A397JP65 | 1-165 | None |
| A0A397SLJ3 | 122-278 | None |
| A0A372QT38 | 142-293 | None |
| A0A2Z6RAN5 | 3-145 | None |
| A0A397IX34 | 343-504 | None |
| A0A015KQT9 | 28-179 | None |
| U9T1T8 | 161-321 | None |
| A0A2I1H5T2 | 70-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.