DPCstruct | MC17943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 266 ± 60 aa |
| Standard deviation of domain lengths | 59.74 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.57 |
| Pfam Score | 98.31 |
| Assigned Pfam label(s) | CL0123- PF14474 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D3AWK7 | 613-881 | NLCPYCDEPLPFNPTEHIENLKARLEKLSKPAPTTRNPNARDLHWQQAIEFCTLHRAEATIIPLGIQAGYPETMDFKNLDRRLEEGW… |
| A0A2I1FLE0 | 24-268 | EIQNLTTLSQHCTLPSPQVPHFDEPDFLSNKLNLENDQDKNIECPYCDETLPNPLPSKVSEYLNDISTGKKSACTIVEQYEFCLVHK… |
| A0A066WLB8 | 2-205 | None |
| A0A372QTG1 | 120-354 | None |
| A0A146II59 | 773-1074 | None |
| A0A0H2R2Q7 | 341-685 | None |
| I2GW59 | 32-385 | None |
| A0A0A2V3G1 | 327-555 | None |
| A0A2N0QEA6 | 157-423 | None |
| A0A0D2X8B4 | 4-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.