DPCstruct | MC17941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 107 ± 18 aa |
| Standard deviation of domain lengths | 17.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QSC5 | 2-84 | VKTYLEGFFLAGNVNKTDRMSAKEMVMQLKNLAEEGEIQESEVPEVKTVEGWITRYSASLRKEAAEKRVLRETNKRLENESNN |
| A0A2I1FHH0 | 43-167 | GLANETEMIQDDISENQENQNIIWNSTYEFPLKSGWALKSKQKYGKKGGGKRISKRVWKLLEEYFLEGDVDKSKRFTATTMLENLRN… |
| A0A397JJA1 | 8-125 | None |
| A0A397JJ19 | 49-161 | None |
| A0A397JGV8 | 76-191 | None |
| A0A397UGX3 | 221-326 | None |
| A0A397UG92 | 15-117 | None |
| A0A397UFX3 | 36-156 | None |
| A0A397VBU9 | 61-194 | None |
| A0A397U408 | 105-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.