DPCstruct | MC17940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 184 ± 26 aa |
| Standard deviation of domain lengths | 26.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015KWF0 | 2-171 | PNKEIFIGYTFFRPEKVKRYTGADTIYSTRKGKSYILLHVNSLQKEKDMLTIVTNNRHIIKKYDKPYLINSDRPMMNTKYRISKYLT… |
| A0A2I1FH00 | 1-181 | MDSSPDSTTPPPISQAILRLYKPQKILDVSMRISKLSPYLSCDTRGSGTLYNTKKGRYYLIRLSEKADLPLTEINKYLIYTNDIELS… |
| A0A372QT92 | 47-245 | None |
| A0A2I1GKB9 | 4-123 | None |
| A0A2I1F8P8 | 74-277 | None |
| A0A2Z6RS17 | 6-159 | None |
| A0A2H5S8I7 | 246-410 | None |
| A0A2I1GL98 | 242-434 | None |
| U9V486 | 46-255 | None |
| A0A2I1GRY3 | 51-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.