DPCstruct | MC17939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 250 ± 45 aa |
| Standard deviation of domain lengths | 44.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0PXS9 | 2-284 | VYHNLFGENKILAQKPKPRLIDLILNLTFYGWKNIRNLIINRFENIKDIEYLTMIDLLDNSLPLTLEIYAKLFRYGFYEGYLESIVK… |
| A0A2I1FG77 | 75-292 | IWVLFQRLRRHNYNKVPLIFLTKVIDAERTNRFSFKDAFVNSRNSTISHIKLDYLEKKTSLFLLSLFDDIYNNIGNTQQVNRNKYPN… |
| A0A397JL65 | 10-232 | None |
| A0A397JK34 | 127-373 | None |
| A0A397JHZ6 | 461-704 | None |
| A0A397JDW0 | 120-478 | None |
| A0A397U4F4 | 368-610 | None |
| A0A397JAU9 | 856-1127 | None |
| A0A397U9I6 | 7-203 | None |
| A0A397JUH7 | 86-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.