DPCstruct | MC17938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 21.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 39.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1HLQ2 | 8-155 | IKNFFEPTSKLKSSPIQISFVPFNINKSVCDCGNVYSETILLQKFCKNCLFVYIKNIKNFDAYLDIHYKKHLGIEEQFEILSEGLYF… |
| A0A2I1FG61 | 1-130 | MEFANSLDSRSSPGLIQFIPFINSENECYNCKGSYSTTRLFYQKYCEYCLMSYIEYTDNDNLDVSIGTIYSQCKEHEPRSLDFCTRN… |
| A0A2I1EZA0 | 1-160 | None |
| A0A2I1EIV5 | 1-160 | None |
| A0A372Q153 | 74-220 | None |
| A0A372QK40 | 154-302 | None |
| A0A372QLW1 | 14-145 | None |
| A0A2I1EUE6 | 1-132 | None |
| A0A2Z6RDG7 | 1-155 | None |
| A0A015MRG4 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.