DPCstruct | MC17934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 131 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535AQN8 | 1-96 | MRYDGEGFSDLSGGQRRGATYLGNVNLELTLDAQRLIGWSGLTVFLYGLGIHGGHPSTLAGDAQGVSNIEGPTKWPLEEAWIQQDLF… |
| A0A2S3VWY6 | 12-133 | ARDWMARHGISFDIQEVDELWGNTTGGTASRADGASGSGTGPAYDGVTMPTLTVDLEKLIGLKGGTFNVRALQLRGRSISQDHLANF… |
| A0A2V7DFG6 | 23-159 | None |
| A0A485BVU6 | 4-117 | None |
| A0A7D5D863 | 2-106 | None |
| Q05RP4 | 24-174 | None |
| A0A3G9FU32 | 19-124 | None |
| A0A1Z9X3V8 | 5-113 | None |
| A0A839A0G9 | 68-218 | None |
| A0A562KIX2 | 13-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.