DPCstruct | MC17933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 21.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.04 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF08785- PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4IP85 | 12-137 | GTSDVGSIDPVKDFEKMISRRDVDLVDKAIEQMKERILQLLNDSVKDQLYPKAFGCVEALRVGCVQEEEPAAFNTFLRLMRSMHEGK… |
| A0A425BTZ6 | 22-172 | LDVESLLGQEKRQKISHDNAVPEFRQMLNTAESVGSIQEAADQMASIIRTLVTRSLGDSGYGRAIENMRVMRDELTALEEPTMYNNF… |
| A0A553NL83 | 2-136 | None |
| A0A517LEN3 | 571-748 | None |
| D3BLM6 | 37-161 | None |
| A0A7N0T050 | 215-360 | None |
| A0A842Z7H9 | 34-170 | None |
| A0A0A9E3K7 | 1-110 | None |
| S4PBI3 | 68-232 | None |
| T1FVR5 | 52-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.