DPCstruct | MC17931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 276 ± 24 aa |
| Standard deviation of domain lengths | 23.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366PVE8 | 141-393 | WAPLVPLTQPRVVTESFGNIVRRVDIEDESVPASTELEPAVDDLHASKSDLVQSPMGIWAMITPPTFVQSAGSSPYVNPDPEATFAD… |
| A0A425BRF5 | 1-237 | MVLEASMDEYLEARKGEKTNVAVWALVVPADVAKLQTSEPSGTGSYGGSELLVDQAEIKLSWSKPSLDTGFVGNWIDMGATFCRVLS… |
| A0A3M7HBC1 | 257-539 | None |
| A0A2A9PLS4 | 250-504 | None |
| A0A165HKU1 | 155-434 | None |
| A0A2P5IEG0 | 90-386 | None |
| A0A0D2DGQ7 | 346-620 | None |
| A0A178Z6Q4 | 655-925 | None |
| A0A3D8RJ24 | 412-737 | None |
| A0A6G1H066 | 312-589 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.