DPCstruct | MC17930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 221 ± 19 aa |
| Standard deviation of domain lengths | 19.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A3PKE1 | 168-394 | QALMQWTRKTGHDPALVGLIRVYKDYYPEVIVGDVTSGRASHPNREWRERLGEIQEDHLRRTEDELVSTHRNFRVSRKSVKERKYGF… |
| A0A1E3QFS7 | 172-397 | QYLLEMQNKYRESQHLTGLLLLYKEYFPEIVIDRFAKLRGALFKYPDPQFLTIIHEVHARANSLSGEVPSFSRDGLSNLKRRKLNIP… |
| A0A163IXU1 | 168-393 | None |
| A0A4U0XRC7 | 167-394 | None |
| Q2U982 | 1-242 | None |
| A0A395IPU3 | 3-185 | None |
| A0A2W1D0M0 | 152-381 | None |
| E0VRA9 | 105-344 | None |
| A0A0B1P5A1 | 1-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.