DPCstruct | MC1793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 265 ± 39 aa |
| Standard deviation of domain lengths | 39.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF07196- PF00669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L1QMQ3 | 104-299 | QSLKTRTMLQADINRLMEELDNIANTTSFNGKQLLSGNFINQEFQIGASSNQTVKATIGATQSSKIGLTRFETGGRISSSGEVQFTL… |
| A0A823MBV9 | 1-305 | KAMDEQLKILDTIKTKATQAAQDGQSLKTRTMLQADINRLMEELDNIANTTSFNGKQLLSGNFINQEFQIGASSNQTVKATIGATQS… |
| A0A7Z9YZB9 | 3-287 | None |
| A0A3M8FF65 | 1-215 | None |
| A0A2H0PQA7 | 192-520 | None |
| A0A7C8FA78 | 81-350 | None |
| A0A2P6FSC7 | 113-348 | None |
| A0A2D5HKJ7 | 108-319 | None |
| A0A357IC59 | 28-343 | None |
| A0A1W9T0X2 | 81-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.