DPCstruct | MC17929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 39.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A425BNQ0 | 1-66 | MVWTQIENVAIDLENFSRHAGRTTINTDDVLLVTRRNDALTEIMQDFIDQEKAKAAKGKGKAKGRG |
| A0A1X0QYM3 | 38-102 | LTEVLASQIKLLGQDLEAFARHGRRSVISMEDVKLCARRNDTLYEVISETAKEIAEDANKRKQRK |
| A0A8B6CQW3 | 50-121 | None |
| A0A7J7BTS6 | 1-75 | None |
| A0A0L1JDU3 | 91-148 | None |
| K1WV76 | 46-116 | None |
| A0A7I0ZAM6 | 57-118 | None |
| A0A485NEF6 | 54-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.