DPCstruct | MC17928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 430 ± 68 aa |
| Standard deviation of domain lengths | 68.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.21 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0129- PF00330- CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1BPN4 | 85-510 | NSPQALYGAVFYIVFDVGLRKLFKKLSISFPSMMAGCVGLFVAMVLAEVVSPGSGDAVFDSLSPGSAFLTKWMPAFFVPGLVMLPLA… |
| A0A425BMU2 | 48-484 | PAGVICILLICFGVNLLISLGSISFPSSVACLVLLFLALTICEMIIGERKTRAIVNVINVPAGFALRWINCLFVPAFVVLPLGGSGA… |
| A0A4Z0Z1W0 | 349-824 | None |
| A0A834U064 | 648-1077 | None |
| A0A507BQA8 | 4-333 | None |
| A0A2S4VUK6 | 560-1103 | None |
| A0A7J7IIJ6 | 94-597 | None |
| A0A0E9NQ73 | 261-823 | None |
| A0A180GQH3 | 2-418 | None |
| A0A1Q9EG23 | 523-953 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.