DPCstruct | MC17922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 155 ± 19 aa |
| Standard deviation of domain lengths | 19.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0087 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4D775 | 7-167 | VHPSLGESANKLEENVYYFGRAMENLLLRFGKRCAGPADQGHSQPGPGDQVAGLHAEPRPQTVLEEQLVLKRVANVLINLYGRMAVL… |
| A0A7Y5PAI2 | 5-129 | VHEALAGEAETVAGIIHDLALAVESLLMRHGKAVIEQQFLQLRLANAAIDIYLAVATLSRTTWEIERAGSAEAASPELDCARVFIPA… |
| A0A820REK9 | 60-229 | None |
| A0A6A4W3F0 | 96-240 | None |
| A0A158QP65 | 351-502 | None |
| A0A813XLN8 | 481-653 | None |
| A0A212F0N2 | 2-171 | None |
| A0A0M3IV46 | 12-142 | None |
| A0A838QC92 | 1-173 | None |
| A0A023FGS6 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.