DPCstruct | MC17921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15300 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4D2N7 | 11-84 | FPQSIEEINVGIKHQLMKEVRQFGRKYEKIFKLLEEVRGPVEVKKQFVEFTIKEAARFKRRDLIKHLEKILEKT |
| A0A833ZAZ5 | 200-278 | TPAMAQGINADIKHQLMKEVRKFGRKYERIFILLEGVQGPLAVKKQFVEFTIKEAARFKRRVLIQYLEKVLEKIDSHHL |
| A0A2K6PJ77 | 322-397 | None |
| A6NJ88 | 513-599 | None |
| A0A7J8DWT7 | 2-80 | None |
| A0A2G9SAP0 | 470-550 | None |
| B7PMU7 | 1-78 | None |
| A0A812DRG9 | 320-390 | None |
| A0A3Q0DXN0 | 157-231 | None |
| A0A1Y1JZH1 | 88-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.