DPCstruct | MC17920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8EI61 | 161-257 | MGYPYECVLRAMKKKGENIEQILDYLFVHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQ… |
| A0A5E4CVP5 | 1-89 | MKKKGEDTEQMLDYLSAHGQLFKKGFDPLLVEEALEMHQCLEEKMKFLQLMSKFKEAGFELKDIKEVLLLHNNDQDNAFEDVMARAG… |
| A0A2U3VCG4 | 354-450 | None |
| A0A443SPT6 | 1-98 | None |
| A0A7J7W4S6 | 16-112 | None |
| A0A0P4WA27 | 624-732 | None |
| A0A4Y7NM75 | 530-640 | None |
| A0A4Y2CBQ4 | 770-877 | None |
| A0A3S0Z8A3 | 555-663 | None |
| A0A7R9G7L0 | 461-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.