DPCstruct | MC1792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 188 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9K836 | 35-221 | YTPLIQNNYMYLIKKSNQNFGKTIKYVQYLISTHYIEYLKRHNQEKIVNSLHFDKNRFKEMSKILFKNIDSNIIYELNCEYYIKNYL… |
| A0A825Q3T1 | 7-183 | YLEILEKGYLELLNFVAKQDKIPIFIQNVILYELFWQVQELVNHPEKLSFIDQAKIHKYLDLLDQICYFIDSENIIKFNFNSFLFLH… |
| A0A179CWH5 | 311-491 | None |
| A0A0R2JLW3 | 350-552 | None |
| A0A0S2CGT4 | 2-196 | None |
| D2MZN8 | 123-294 | None |
| A0A7U8ZYC2 | 40-231 | None |
| A0A0H5AJW9 | 271-453 | None |
| A0A377NFK5 | 50-241 | None |
| A0A832SW10 | 502-710 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.