DPCstruct | MC17917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 167 ± 35 aa |
| Standard deviation of domain lengths | 34.96 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4CNR8 | 25-160 | LQAGAVCSDFFNKAVPPDVYTDQVIKRMIKCCSLLNCHTQVAILCQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTY… |
| B3RVA3 | 22-178 | TQGDFNYIIRKYPTSLRNYIEAGAISSSYFLNEVPTDIWDDLVYRRMISCCSALFCHTQAAVLCQFLTPVDFNMAIRAVQQHNSEDA… |
| A0A267FYG3 | 2-111 | None |
| A0A6V7VL18 | 257-451 | None |
| A0A7S4CDS8 | 50-246 | None |
| A0A3Q0KQ69 | 1363-1635 | None |
| F0W0J5 | 817-1007 | None |
| A0A564Y9V7 | 926-1110 | None |
| F4Q552 | 123-314 | None |
| A0A6B2EC38 | 222-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.