DPCstruct | MC17914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 17.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2TF09 | 241-327 | GGCGSYYKAVRQETSLWGQGWATSDFGHSILESVKNKCAAWDYTWKFEYGLGDDGREWTASFQGGVFQRGCIGHAIGDISGISGFGC |
| A0A1T3CNY7 | 55-166 | TTTTSEVPSTSSEEATPEPTQTPEVTCGIALYPPIMWRLDIIDMTGSWVLDDEGKTLQKEIKGCGAVTGWEWFKRADGTRECRFNLP… |
| A0A1L7W6K2 | 852-950 | None |
| A0A6A5WZK3 | 426-524 | None |
| A0A1L9SZ94 | 6-152 | None |
| A0A2K0VYQ8 | 333-475 | None |
| A0A6A6AKT1 | 363-480 | None |
| A0A4Y8DHQ8 | 12-108 | None |
| A0A4S9PH36 | 14-111 | None |
| A0A0G2F803 | 153-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.