DPCstruct | MC17911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 357 ± 57 aa |
| Standard deviation of domain lengths | 57.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495DDS3 | 16-400 | LDVSAGSELRDELLRHLDAEAQDARLKLTDPFGPGTSNLTGGMLAWYQGSIRGRRDAALRAIADAFRDIAANRNAGGVFLDRDLQQV… |
| A0A257ZSW3 | 6-379 | RPGGALPPFTAHHLAEVVEAGRHGAADALENQPAPSSAVPSQTEMTLLARVIELFTAIRQEASATLNGLQAEIAARREAFTQERYEG… |
| A0A1I1R6J1 | 57-522 | None |
| A0A6A2EHF2 | 12-316 | None |
| A0A2D6T192 | 4-390 | None |
| A0A2W4XBU8 | 1-286 | None |
| A0A4R2J380 | 2-346 | None |
| A0A7X0IFR3 | 32-430 | None |
| A0A7D7ZXH7 | 4-246 | None |
| A0A2E3D4D9 | 1-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.