DPCstruct | MC1791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 75.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828CYR6 | 1-106 | MGFGSVNKGVMLAGVSSVSAYMSSAGSGFSAGSGYSVGSGKNYSAVLTTNAITISAASQLSAVYNVSAGSGFSSQSGLSQFATMKTT… |
| A0A825YDT1 | 107-220 | GGGKFVFTQAVSSISAFMSAGGSGFSKGSGFSVGSGKNLSVGLTEGIKIVSSAASMSNTYVVSSGSGFSSGSGNSQFAALKATAANT… |
| A0A823S8C7 | 76-191 | None |
| A0A824XEI4 | 163-266 | None |
| A0A694B9H6 | 59-164 | None |
| A0A825Y295 | 120-216 | None |
| A0A825VS75 | 282-386 | None |
| A0A826DXT0 | 201-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.