DPCstruct | MC17908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 5.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5P6I0 | 6-70 | DVGEAMRMMERMERISKDLPGLDCGSCGSPSCRTLAEDIVRGQAVEMDCIFKLRDKLRILAQEMA |
| A0A6P1YCS6 | 1-58 | MKLDENIVEAIRKIEEIKKLTNLLPGLDCGSCGAPSCRALAEDIVRGYGKIEDCIFRD |
| A0A847IZ24 | 180-241 | None |
| A0A351J2M3 | 233-294 | None |
| A0A6G2CHJ6 | 103-161 | None |
| A0A1V6ESN8 | 120-174 | None |
| A0A7V3LIR4 | 424-481 | None |
| A0A645BVL5 | 136-209 | None |
| A0A3C0BH35 | 446-499 | None |
| A0A3A6P041 | 364-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.