DPCstruct | MC17907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 57.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Z4YKY0 | 18-100 | LVTWVKTFGPLAAGNGTNLDEYVALVDGVFLNQVMLQINPKSESQRVNKKVNNDASLRIHNLSILVKQIKFYYQETLQQLIMM |
| A0A673V1T2 | 1-87 | LGGSEERIQAGVKTFGSFGSGGQDNLTMYMDLADGIFLNQIMLQIDPRPTNQRINKHVNNDVNLRIQNLTILVRNIKTYYQGGPLLQ |
| A0A803YHF1 | 18-100 | None |
| A0A673HZK3 | 18-96 | None |
| A0A671EID6 | 17-90 | None |
| A0A3Q2Q1D8 | 1-94 | None |
| A0A3B3ZIG9 | 1-90 | None |
| A0A4W5PNC1 | 7-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.