DPCstruct | MC17906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 117 ± 23 aa |
| Standard deviation of domain lengths | 22.72 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5LIU1 | 5-94 | DQDWYYIRAAAVARKVYLRPGRGVGGLSKAFGTKARRGTMTNTHKPAATGIIRHVLQQLEALKVVEKMENGGRTVTRVGQQDLDRIA… |
| A0A673UR90 | 82-217 | DLGGGFGGDLNRAFLSVGPRSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSH… |
| A0A835LIK9 | 25-158 | None |
| A0A6S7HC27 | 14-142 | None |
| A0A438E308 | 143-261 | None |
| A0A812JHW2 | 134-334 | None |
| A0A803QKS7 | 82-189 | None |
| A0A0E0GPB9 | 206-348 | None |
| A0A811MXP9 | 14-146 | None |
| A0A179I401 | 35-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.