DPCstruct | MC17903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 127 ± 17 aa |
| Standard deviation of domain lengths | 16.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F0YEE0 | 2-114 | AIKVLEQVAKIPVVKVDRNQFLMDKFGKGLSRDQVNQLLLDGPVNMVDKERLDKVAKTCIMDNVLMASGASVLAGLPGGVAMAITIP… |
| A0A2G6CI12 | 28-147 | STEELTYQLIEKALSLPGVKINRRDFLVHALGDEVDVDDIPDLLRDGPLKSGLIARRKLNKIAVKLCDQNRLNSSIASFASGLPGGL… |
| A0A134A6Y6 | 26-165 | None |
| A0A5R9DW40 | 11-121 | None |
| A0A1V5NXK6 | 11-139 | None |
| A0A374V496 | 1-153 | None |
| A0A2N2KRA9 | 1-167 | None |
| A0A2V2EPD8 | 117-234 | None |
| A0A123SCD4 | 7-122 | None |
| A0A7T0LMS1 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.