DPCstruct | MC17900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151WRG4 | 1-71 | MFSRAVFNFFSGALLIIAFIPDAASYNKYGRTCKDIGCRTDETCVMAEDPCNGYTDKCGRYPTCRRTSDVS |
| A0A6M2DYJ6 | 2-73 | TNILAICLLLSGSLLVEGYSKYGRTCADIGCTPSEVCVMAEDPCSYGQRDSCGTYPTCKRRDSVSSHSEPAK |
| A0A1B0BDH4 | 57-124 | None |
| A0A5E4QDM9 | 1-72 | None |
| A0A336MPE1 | 9-93 | None |
| A0A2A4J3E7 | 5-76 | None |
| E0W1F3 | 2-63 | None |
| A0A1Y1MDH4 | 2-65 | None |
| A0A1Q3FPM6 | 7-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.