DPCstruct | MC1790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 175 ± 14 aa |
| Standard deviation of domain lengths | 13.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6W9S2 | 6-164 | NGKKFVFSSGAGGWQTVLNFSQDGNFTAKFEDYDLDSVAICEFNGKLSIDSKVNETAYILRLDRAEITTPINTQEVKNIGGKDMTVR… |
| A0A1Q9J395 | 51-228 | SEPIQETQTSETEQDTTEENLGFSFSDLKNVQFVFSSGVGGWCTTLDIAEDGSFSGVYQDSDMGDTGDGYPNGTYYYAEFTGKFAQL… |
| A0A173TGD7 | 39-216 | None |
| A0A1H9APP4 | 323-479 | None |
| U1SM95 | 35-214 | None |
| A0A095ZA35 | 56-248 | None |
| A0A3B9K4E0 | 61-258 | None |
| A0A1V8QFI3 | 682-859 | None |
| A0A7U9R867 | 83-248 | None |
| R9IKT7 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.