DPCstruct | MC179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 191 ± 17 aa |
| Standard deviation of domain lengths | 17.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0BTV1 | 1-191 | MIKNDLKNILSKQFFVGFTYLIFGLFLVLKKISPIYLLFCLAFMQFYSYFIHVLFHTIPYIREVHLIHHEKKIISKKLDLLFETILN… |
| A0A6C0EXV3 | 48-224 | TNNLKKNMLSWLLIGTTVSIISYPNILLGITTFFFFMFIAYYYHVVTHVHKNIFSIVHHYHHEHDNFFSHFIQVVLELSIPYPFVMI… |
| A0A6C0CY78 | 5-192 | None |
| A0A2D9P6C8 | 3-168 | None |
| A0A6C0JXZ9 | 1-222 | None |
| A0A6C0I2A1 | 48-265 | None |
| A0A6C0HZC7 | 2-174 | None |
| A0A6C0KT06 | 6-191 | None |
| A0A6C0AY54 | 9-204 | None |
| A0A6C0B9N3 | 16-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.