DPCstruct | MC17899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 5 aa |
| Standard deviation of domain lengths | 5.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 66.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 56.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6LCV8 | 1-102 | MDPEILARLMPQGKETVRPACKKCGYAGHLTYQCRNFIRIDPNKDIVLDVSSTSSDTEEDYTTPLTLLRDEELRTKLKEVKKSKAKK… |
| E9J9N3 | 1-105 | MDPGVLSRLIPQSKEQVRPACKKCGYAGHLTYQCRNFIKIDPNKEIVLDVSSTSSDSDENYVTPLTELRERELRKKLREAKKKRREK… |
| A0A812DYL1 | 1-111 | None |
| A0A0P4WTN8 | 8-114 | None |
| A0A090XEW3 | 7-106 | None |
| A0A7E5VIZ3 | 5-110 | None |
| A0A4P6D9L2 | 1-101 | None |
| A0A0K8S4C5 | 1-103 | None |
| A0A1S3JKR4 | 7-103 | None |
| A0A6A4ISJ1 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.