DPCstruct | MC17898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9J9L6 | 1-81 | RFLLQCLEDLDCSLRKLNSRLFVIRGQPADALPKLFKEWGTTNLTFEEDPEPFGRVRDHNISALCEELGISVVQRISHTLY |
| A0A7R8ZMU9 | 6-80 | LEDLDRSLRKLNSRLFVIRGQPADVLPKLYKDWQITHLTMEAEPEPFGRARDKNIIAISREYGVHVSIKTSHTLY |
| A0A3Q2WQ51 | 25-104 | None |
| A0A2I0T0A1 | 10-89 | None |
| A0A7R9DTE4 | 2-80 | None |
| K1PMJ9 | 748-828 | None |
| E9HTU2 | 10-90 | None |
| A0A5C6MN71 | 5-86 | None |
| A0A834C5P5 | 53-133 | None |
| A0A4U0ULN3 | 311-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.