DPCstruct | MC17897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 15.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 58.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226F5E2 | 133-223 | MKYLVSRRKFREALKPYDVKDVIEQYSAGHVDLLGRVKGVQARLDQILGRQGSKARDVYDSKICLAARIVKVERQVEDIEGKVEQLL… |
| E9J6N0 | 1-116 | LTEAHRNAIRAIRKIKYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGSYLAGIDRAGNVKPMTIGARL… |
| A0A7J8GZW2 | 91-211 | None |
| A0A3P6QZU4 | 113-226 | None |
| A0A2D4IML2 | 2-97 | None |
| A0A267GJ50 | 3-120 | None |
| A0A1S3PCF4 | 1-76 | None |
| A0A5A9PWU4 | 15-107 | None |
| A0A4Y2AGZ3 | 18-137 | None |
| A0A6V7UDF5 | 60-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.