DPCstruct | MC17895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 166 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.88 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0229- PF11979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3IRC4 | 1-163 | MVECFDNLIVPSSPFLVACFIHQCETLWALAIPNRLLYRIGLQASYYPTPIVNRRTRDPVYSSFSDTTVLKVFTDFRNWSYRMLRVH… |
| E9J548 | 1-152 | RWETPWAKVFPLRLLLRLGAEYRYYPCPLVSVRFRNALYFEIGHTVMKVLADFRNFGYTLPGVRGLTIHLKNRTTDVMFPRNRYDQV… |
| A0A1I8F2S8 | 547-716 | None |
| A0A151WXQ4 | 27-210 | None |
| A0A4U5N3W2 | 343-516 | None |
| A0A131ZV19 | 709-842 | None |
| A0A1I8HM31 | 5-172 | None |
| A0A1L8E309 | 697-896 | None |
| A0A6I9Y9J2 | 67-229 | None |
| A0A4Y2BJZ1 | 194-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.