DPCstruct | MC17890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 154 ± 16 aa |
| Standard deviation of domain lengths | 15.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453EZ28 | 1-132 | NTAEDFISFYDEMIPLVQTLPQIVLHREKIFSGLLQRVNMAARLSLEPIFMLIAEFARDILEEFLPFLARHASAILALLSDGGDRDP… |
| A0A2I4HWH0 | 31-177 | VGEIEIDVYRSLDEVKPEPAEGSFFRDCLIEWRELNTAEDFISFYVEIMPLVQTLPLVLLHKELIVSKLLSSLHMKARLSLEPILRL… |
| A0A1Q9E916 | 3-183 | None |
| C5LJT1 | 50-188 | None |
| A0A183KU32 | 1-178 | None |
| F4QEJ0 | 85-261 | None |
| A0A842Z7G5 | 50-180 | None |
| A0A2H2IDZ6 | 33-183 | None |
| A0A0D2ZTC2 | 44-181 | None |
| A0A5K4F7H5 | 1-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.