DPCstruct | MC17888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 14.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16112 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A3ID65 | 9-118 | CILFILTACNNESINEKHRLYLEELGWSIKSFDTKETREISKDSLAFNDSYQFSFLEKYVGKELDVTTYVLNEKDIEGDNIQAILYE… |
| A0A7C6WVQ5 | 92-203 | QVMELFDKHNWTVDYKINSLKEKLPDNLKHKAGEYPVKIYWAYNNELSKEIGLDFTNYLGKDVVVEIYRLREPLPEFLEPRRDARGI… |
| A0A7S8CDU5 | 22-143 | None |
| A0A1V5XJ61 | 20-131 | None |
| A0A1T5MGK2 | 232-351 | None |
| A0A433RKL9 | 4-129 | None |
| A0A0J8D9P1 | 108-233 | None |
| A0A1C7E0E6 | 15-140 | None |
| A0A3B9SXC8 | 72-194 | None |
| A0A2W1LGX2 | 16-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.