DPCstruct | MC17886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 245 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12561- PF20944 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376SCB6 | 322-564 | VFDSRSSTGFSKWNADTQEMEPYEHTIDRAEQITASVNELSESKMAELMAEYAVVKVHMWNGNWTRNIYIPTASADNRGSILTINHE… |
| A0A2G4WQF3 | 1-261 | MVFSESSPTGYLKWNDATHQMEPFSYKVAVRDMLVIGGNVLEGETDDAAYIAKKFETANAITVASRNNDWSGDITIPNAADVPQGRI… |
| A0A2T3JC41 | 999-1259 | None |
| A0A7Y6JLK6 | 422-650 | None |
| A0A812FZX5 | 249-518 | None |
| A0A7U6FXC9 | 206-428 | None |
| A0A4Q0YTS3 | 131-382 | None |
| A0A1I7E9H6 | 523-765 | None |
| A0A0D8LA39 | 1-226 | None |
| A0A140NSV2 | 280-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.