DPCstruct | MC17882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350QYC7 | 169-328 | EQWRADTGKKYDTEEVLRLAIQRDPRRETEGGPHHLYGVAYALRRYLDQGGKLSGTWRKAREYLDEYLAISRKHQQEDGAFSAGGFH… |
| A0A142Y2G6 | 472-641 | IGFSYYLDSNKQWRANDGRIWSISKLIQEELAQPVVGAACGGTHRLMGFSFSVRQRSMQGQPINGQFARADQFVRNYVDYTWTLQNP… |
| A0A354PEA6 | 577-736 | None |
| A0A3E0Q7N9 | 187-393 | None |
| A0A7Y5SMA6 | 70-248 | None |
| A0A3A0DWA2 | 159-330 | None |
| A0A7Y2AH27 | 1-168 | None |
| M5TAJ6 | 681-872 | None |
| M5SU21 | 443-619 | None |
| A0A142XUW5 | 203-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.