DPCstruct | MC17877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 219 ± 26 aa |
| Standard deviation of domain lengths | 26.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9ZA35 | 10-199 | LAPQNRPFALLYLRTTEGMRDANAAGEFSAPEFWDRSVIPTFADYYLDAYAAWQRDGAVDPAWRVAFETLPAGITCTQLIYLGISAH… |
| A0A3D2CHC4 | 10-235 | LTTLNRRETIYTTYERIDGIARLFEDCNDPWGMFPTTYRHITNRIIQAIESGEIEDQRWGEQIVLDFASRYFANLEAALTGGELSYG… |
| A0A820X7Z5 | 6-197 | None |
| A0A4P2PU35 | 10-233 | None |
| A0A1C6LJL8 | 147-371 | None |
| A0A818AM18 | 2-197 | None |
| A0A5C8NIS5 | 61-299 | None |
| A0A4P6V0X7 | 3-223 | None |
| A0A1I6GB64 | 97-327 | None |
| A0A7V3UCX2 | 14-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.