DPCstruct | MC17873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417YFJ1 | 3-75 | KVWWEMRDLEQATGYSDDWLKENILLQPRYKKILDLENGGFVYYPEKRGEKWLFIASKMEEFLETYFSEIFKK |
| A0A5K7WZS3 | 5-77 | KTFWNFKDLEQHTGYKYLWLTRNILFRPEWRKKLDADNGGPVFYPRRPGQRWKFIAEPMEQFLKDNFKDLFRE |
| A0A0R2N124 | 45-115 | None |
| A0A1I2P7B2 | 1-91 | None |
| A0A7X2SZI4 | 2-78 | None |
| A0A848MX65 | 4-104 | None |
| A0A4S0LPS8 | 14-86 | None |
| A0A1E5TN00 | 1-61 | None |
| A0A2T4SUF2 | 1-67 | None |
| W7AY54 | 34-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.