DPCstruct | MC17872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5V1V4 | 34-144 | MACNCKNIDFGSEENFAQQIMVDIPSHMEGYKQARFKEGLSDKICIDPCIIDEVKELWSLGIETHGCCCGHNKTESFVNVHEKDIEK… |
| A0A5K7WX52 | 19-114 | CLYGTYKWVKVINTDQMHHIVKVDACIASEIKFLNDMGVVTLSCCCGHGKRNSHVLISIRSVKVAERLGYNCKMYYYGDGSCHGTYL… |
| A0A1K1LZQ2 | 139-242 | None |
| A0A1G8I7Y1 | 4-85 | None |
| A0A564MBZ7 | 57-145 | None |
| A0A840CY99 | 5-104 | None |
| A0A7X9CPJ7 | 1-111 | None |
| A0A645I9H9 | 2-93 | None |
| A0A5J4SC44 | 1-112 | None |
| A0A0F8XLB3 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.