DPCstruct | MC17870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 207 ± 14 aa |
| Standard deviation of domain lengths | 13.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9EE19 | 89-310 | KCSNIELDTYNSYYFADINTYIHFYRDSAVLIDLTDALKAGKTCKRYYIEHKEWKNEGIWCDLVNNGIRTFTELYNRTITSLNIDTL… |
| A0A437QD60 | 2-184 | CLIDLQTTYLQITLLDETMLDGRQAIKYSLGSSETLEPAWQLIKGCEWRLSRIIAGLETLDFNTNARDNDFANQLSALSVRKFYAKD… |
| A0A2S3QSU3 | 5-214 | None |
| A0A1E5BIN3 | 134-341 | None |
| A0A7Y6Y7Z4 | 17-196 | None |
| A0A558HMJ5 | 120-336 | None |
| A0A1S8L976 | 4-217 | None |
| A0A5M3PTQ6 | 2-221 | None |
| A0A327JIY2 | 12-228 | None |
| A0A2H0KBD7 | 12-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.