DPCstruct | MC17868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 246 ± 38 aa |
| Standard deviation of domain lengths | 37.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z3YM22 | 250-513 | VLETGYAPVVRYPRHWNTIFASEGAEHTRAGKVDGPVQISGDFYCPAARQIIGKNKLVRKTADLLGEDDGFEVQDRRLEALFPLLMG… |
| A0A4R8VVM7 | 3-227 | LRMLGYTVVTDYLDLQLGLKDGYAGSIQGEGALYCPSMPEGLINATVLSRAKEINAATWRKRIVERRQYMLRPKEKPDAKGRVPMMC… |
| A0A2M9J770 | 53-328 | None |
| A0A0Q6R9T3 | 348-606 | None |
| A0A2S3Y1D1 | 2-148 | None |
| A0A2W4MC85 | 227-474 | None |
| A0A6G2JCK5 | 323-645 | None |
| A0A376CLW1 | 315-562 | None |
| A0A846TVW6 | 80-340 | None |
| A0A2E0MQ36 | 48-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.