DPCstruct | MC17861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7QNW2 | 41-149 | AAGATAAPAHASSLRPQATQTYWRFCSKCYGMFYWGYSGNGVCPAGADHLAQGYNFVLPHDVVETPTAQAYWRFCSKCYGMFYWGYS… |
| A0A124HVF1 | 49-142 | PTAQTDWRRCGRCAVMFYDGYPAKGVCPGGGGHVASGKHYVPPHDVAGTPTAQSDWRYCGNCQAMFYDGYAEKGACPAGGGHSAIGY… |
| A0A1H4Q1I5 | 350-448 | None |
| A0A433QCP1 | 1-92 | None |
| A0A2T0K8F5 | 182-269 | None |
| K4QUN9 | 257-355 | None |
| A0A1B1AXV6 | 1-110 | None |
| A0A0H5RME9 | 6-106 | None |
| A0A4V3F6J1 | 197-291 | None |
| A0A0D8BFM9 | 58-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.