DPCstruct | MC1786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 610 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Standard deviation of domain lengths | 15.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5TMD0 | 218-297 | LQSGGRYRLVLLSVGTEKQAAGEASRLAALGYATDVLASETPAGPRYRLLLGGFASYEDAQQYRRIAADRLKITGSWVMR |
| A0A7R7EIP2 | 7-86 | VVISENQLITVYKVQVGLYRSFTNAMNVLSSFVEKGYSGSIIPYQNFYAVQLGSFDELDDAVAFEQELRSAGYDTMIVKV |
| A0A7C1Q678 | 53-165 | None |
| A0A1Y0M7P3 | 8-103 | None |
| A0A2N5YIY4 | 880-965 | None |
| A0A3D2IC39 | 46-197 | None |
| F4KWL0 | 1-95 | None |
| A0A239GZG1 | 139-211 | None |
| A0A2N6FTE1 | 2-73 | None |
| A0L648 | 411-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.