DPCstruct | MC17857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4RU85 | 2-58 | DDMWKVIIADDEMETHHVTRMVLRNYSFEGKKLCFLSAYSGEETLALLHRHPDTAIL |
| A7BL38 | 6-76 | SQKKRSNTETTTANKKSLVKQSPWKVLIVDDEPDIHTMTQLALKHFEFAGKKIQFFQANSGIEAQDILASE |
| A4Y6Y4 | 1-78 | None |
| A7BPT1 | 1-72 | None |
| A0A7U0XP88 | 1-78 | None |
| A0A7X0NFQ0 | 3-73 | None |
| A0A1V1P156 | 1-70 | None |
| A0A1W9XF59 | 20-94 | None |
| A0A3S3UAG7 | 5-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.