DPCstruct | MC17855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 161 ± 37 aa |
| Standard deviation of domain lengths | 36.82 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9W6C4 | 523-660 | ADVQLELEKIIHAVRSELTRDILIKVENIQISILKVLPYIADVNSSDHTIYAIRHTALQYLPETLENYLKLPKDFANNQPIKGNKTA… |
| A0A7W4XXV2 | 104-251 | PPPPAVPELPDPVTTAERRLAAVLVTAETSGGRMDPEAVELVREVDRLLRPLLAQVRTRDADPQVRHDLETLAGEHLPRTVEDYLVL… |
| A0A178GGP5 | 23-271 | None |
| A0A075JCQ3 | 2-123 | None |
| A0A4Y8MAC0 | 2-141 | None |
| A0A1E2URB2 | 57-206 | None |
| A0A495IIA9 | 121-276 | None |
| A0A552UJA0 | 89-241 | None |
| A0A849PFV3 | 36-270 | None |
| A0A3N0BM88 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.