DPCstruct | MC17854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6L0R3 | 53-139 | IERKQVYGVTFEQGRNEFKINEELLNNVVTENKEIPQQAKIDLIIALITLKYTQSNSVCYAKNGQAIGIGAGQQSRIHCTRLAGQKA |
| A0A2B8TRM2 | 2-78 | LLQSADTRGMSLDELKVVSRRAPSEAELRDLLFAWRVAKYVKSNAIVYAKDNRTIGVGAGQMSRVYSARIAGIKAQD |
| A0A6A5L3U7 | 822-916 | None |
| A0A6H5HYQ7 | 725-801 | None |
| A0A5N5QLJ0 | 387-473 | None |
| A0A1I7Y9I1 | 252-338 | None |
| A0A485BJ49 | 108-181 | None |
| A0A377LPX0 | 1-102 | None |
| A0A377DZ48 | 1-78 | None |
| A0A2A2KRH5 | 77-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.