DPCstruct | MC17852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 146 ± 13 aa |
| Standard deviation of domain lengths | 12.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8X4Q4 | 511-629 | QPPPLSSLGEAKNDRYYSRLNIYELSKILELDQYDIEMTKFIEGVILEIFGNYCDFKLGLQTWIRDTDKEKRKSLIQQLYSYSSIFY… |
| A0A1E4TWT3 | 1-143 | MSDTNGQNNNSNFFNPSSNRRHSDSRLSLAELTSFLKLGDDLKETATREKNILTVLKDELGFELGLKTWIRDTSLAKRVQLIENLTE… |
| W6MF93 | 152-286 | None |
| A0A1E3NHT3 | 265-401 | None |
| A0A7D9GXL8 | 284-440 | None |
| A0A1E3PQD4 | 306-441 | None |
| A0A0J9XFI7 | 204-360 | None |
| B9W9X7 | 604-748 | None |
| A0A1X7R449 | 227-367 | None |
| A0A0L0CCW7 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.