DPCstruct | MC17850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 162 ± 21 aa |
| Standard deviation of domain lengths | 20.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9VMA4 | 32-186 | RGAEELRSLLIDQSNLPAAAGRLAERLASSSKLFQRGAGLVKLIETADGFSTLDLNVHDVVNHAHQVCRPVVKKIVRGEVVVEAVTL… |
| A0A1V0PSY2 | 308-451 | EPDMAEWGEEKLAAKMVHGVPVVFQFEGDVCAARHGKRQMLSDRQFAAVLNDNTKWAKSEGDSKRAVFAPKEVYEHMFHRQPKSYAE… |
| A0A426U5K1 | 355-484 | None |
| A0A7V8V5X3 | 3-118 | None |
| A0A1C3RF61 | 501-692 | None |
| A0A1N7LEL0 | 355-541 | None |
| A0A7U7G9R6 | 275-461 | None |
| A0A1Q7BDP2 | 28-177 | None |
| A0A4Q8YDA1 | 303-487 | None |
| A0A257DGD9 | 431-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.