DPCstruct | MC1785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 109 ± 24 aa |
| Standard deviation of domain lengths | 24.36 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0380 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6C881 | 17-118 | EVSHSRAGLLFIESYRELPLLSWPRRLIDTVVDLEESMILFRSHHARMVERMIGRRMGTGGSSGVDYLDMTIKYRIFKDLWAVRTML… |
| A0A4V6KRB6 | 4-78 | LIYDNPQTYWAAYEMAEKLVDIEESFHLWRFRHMKTVERIIGFKSGTGGSSGVSFLKKALELTFFPELLDVRTEI |
| A0A7R9TBM8 | 37-143 | None |
| A0A7Y6AEF1 | 11-111 | None |
| A0A7K1AF59 | 2-81 | None |
| A0A2T7PNB9 | 197-323 | None |
| A0A6L5CYK1 | 246-390 | None |
| A0A562CIG6 | 37-117 | None |
| A0A7S0MFR1 | 177-303 | None |
| D9UDU4 | 17-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.