DPCstruct | MC17846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 140 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0E090 | 158-313 | SKCDYLGSMIVVYHKDKKSSLKKLEFKDKVISHVNDLFYYFEKPDSNNTMEVLGPCGIVRAVNYAPEIIIKEHASSLVIYKKMEFHV… |
| A0A0N5CG10 | 5-136 | INPRDDKNFYANQEFYYFKKPEENDGRKIIENCGKYRGYKNQPHFNLPDYSDNSTIDEVKKIIINESYYEKEKKIKINLKVGDDIKF… |
| A0A0N4ZZR2 | 195-324 | None |
| A0A0N5A5X5 | 31-161 | None |
| A0A090LDE4 | 124-252 | None |
| A0A0K0G483 | 120-274 | None |
| A0A0K0FSG9 | 1-133 | None |
| A0A0N4ZFT2 | 151-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.